PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn279311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 322aa    MW: 36917.8 Da    PI: 8.2805
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn279311genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260105.54.3e-333100198
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                 aCa+Ck++r+kC+++Cvlap f a+++++f++vhk+FG+snv+k++k+l+ee++++a++sl++eA +r++dPv G +g ++k+ ++l+  k++ ++++
  Achn279311   3 ACASCKHQRKKCSEKCVLAPFFTANKSREFQAVHKVFGVSNVTKIVKDLKEEDKKRAIDSLIWEAFCRQKDPVLGPYGEYRKVYEELKLYKSQYQHVQ 100
                 7****************************************************************************************999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.2052103IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-323100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MPACASCKHQ RKKCSEKCVL APFFTANKSR EFQAVHKVFG VSNVTKIVKD LKEEDKKRAI  60
DSLIWEAFCR QKDPVLGPYG EYRKVYEELK LYKSQYQHVQ VPPQGNGMYK PTPNLVGWNN  120
NNGISYNTLN YIHNDHESSI HADSSSAPYS YSSDHLLHGL ERIRQERDVS SVIILPQQHS  180
INGLNQQYYL SDEKYYSTEV IKCKDGSKSF TRARINDNFC DCPDGTDEPD CCDGSDEYDG  240
SIICHNTCVM GGNVAYNTIN YGSTNTDLDV KVTEKRVMLE DPTQKINGLK IFIILQAILI  300
SFVVAFRLYR WRVRLRRRHF R*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098374.15e-72PREDICTED: LOB domain-containing protein 2
TrEMBLK4DCG86e-66K4DCG8_SOLLC; Uncharacterized protein
STRINGSolyc12g010810.1.12e-65(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.13e-44LOB domain-containing protein 2